Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCTN2 Rabbit pAb (APR28071N)

Product Specifications

Background

This gene encodes a type I membrane protein that belongs to the tectonic family. Studies in mice suggest that this protein may be involved in hedgehog signaling, and essential for ciliogenesis. Mutations in this gene are associated with Meckel syndrome type 8. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCTN2 Rabbit pAb (APR28071N) .

Synonyms

TCTN2; C12orf38; JBTS24; MKS8; TECT2

Gene ID

79867

UniProt

Q96GX1

Cellular Locus

Cytoplasm, Membrane, Single-pass type I membrane protein, cilium basal body, cytoskeleton

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 76kDa Observed MW: 77kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79867

Uniprot URL

https://www.uniprot.org/uniprot/Q96GX1

AA Sequence

VKFLSYNSGNEEELSGNPGYQLGKPVRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQCGLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYYQGELHSQCVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT10A antibody
70R-13410 100 ul

WNT10A antibody

Sign In for Pricing
View Details
Renin Mouse Monoclonal Antibody (PerCP-Cy5.5)
orb2363502 100 µL

Renin Mouse Monoclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Human Myeloblastin ELISA Kit
MBS8415023-01 1 Kit

Human Myeloblastin ELISA Kit

Sign In for Pricing
View Details
Human Myeloblastin ELISA Kit
MBS8415023-02 5x 1 Kit

Human Myeloblastin ELISA Kit

Sign In for Pricing
View Details
DNAJB6 Antibody
orb1327586 100 µg

DNAJB6 Antibody

Sign In for Pricing
View Details
Gliadin IgM ELISA
MBS494205-01 96 Tests

Gliadin IgM ELISA

Sign In for Pricing
View Details