Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA12 Rabbit pAb (APR28059N)

Product Specifications

Background

This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NDUFA12 Rabbit pAb (APR28059N) .

Synonyms

NDUFA12; B17.2; DAP13

Gene ID

55967

UniProt

Q9UI09

Cellular Locus

Matrix side, Mitochondrion inner membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 7kDa/17kDa Observed MW: 17kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55967

Uniprot URL

https://www.uniprot.org/uniprot/Q9UI09

AA Sequence

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SEMA3E/Semaphorin-3E ELISA Kit
E2236Hu 96 Tests

Human SEMA3E/Semaphorin-3E ELISA Kit

Sign In for Pricing
View Details
Prolactin (PRL) (NM_000948) Human Untagged Clone
SC122581 10 µg

Prolactin (PRL) (NM_000948) Human Untagged Clone

Sign In for Pricing
View Details
CAP2 Rabbit Polyclonal Antibody
orb585790 100 µL

CAP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Caulobacter sp. Formamidopyrimidine-DNA glycosylase (mutM)
MBS1196424-01 0.02 mg (E-Coli)

Recombinant Caulobacter sp. Formamidopyrimidine-DNA glycosylase (mutM)

Sign In for Pricing
View Details
Recombinant Caulobacter sp. Formamidopyrimidine-DNA glycosylase (mutM)
MBS1196424-02 0.02 mg (Yeast)

Recombinant Caulobacter sp. Formamidopyrimidine-DNA glycosylase (mutM)

Sign In for Pricing
View Details
Recombinant Caulobacter sp. Formamidopyrimidine-DNA glycosylase (mutM)
MBS1196424-03 0.1 mg (E-Coli)

Recombinant Caulobacter sp. Formamidopyrimidine-DNA glycosylase (mutM)

Sign In for Pricing
View Details