Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIN Rabbit pAb (APR28045N)

Product Specifications

Background

This gene encodes one of the proteins important for centrosomal function. This protein is important for positioning and anchoring the microtubules minus-ends in epithelial cells. Localization of this protein to the centrosome requires three leucine zippers in the central coiled-coil domain. Multiple alternatively spliced transcript variants that encode different isoforms have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NIN Rabbit pAb (APR28045N) .

Synonyms

NIN; SCKL7; ninein

Gene ID

51199

UniProt

Q8N4C6

Cellular Locus

Cytoplasm, centrosome, cytoskeleton, microtubule organizing center

Applications

IF (Human, Homo sapiens) WB (Homo sapiens)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 147kDa/160kDa/236-248kDa Observed MW: 190kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51199

Uniprot URL

https://www.uniprot.org/uniprot/Q8N4C6

AA Sequence

MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEALILILSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQESVEEFPEVTVIEPLDEEARPSHIPAGDCSEHWKTQRSEEYEAEGQLRFWNPDDLNASQSGSSPPQDWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQNVDGEMLEEVFHNLDPDGTMSVEDFFYGLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRTTTSSAMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein
MBS1021460-01 0.02 mg (E-Coli)

Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein

Sign In for Pricing
View Details
Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein
MBS1021460-02 0.1 mg (E-Coli)

Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein

Sign In for Pricing
View Details
Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein
MBS1021460-03 0.02 mg (Yeast)

Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein

Sign In for Pricing
View Details
Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein
MBS1021460-04 0.1 mg (Yeast)

Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein

Sign In for Pricing
View Details
Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein
MBS1021460-05 0.02 mg (Baculovirus)

Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein

Sign In for Pricing
View Details
Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein
MBS1021460-06 0.02 mg (Mammalian-Cell)

Recombinant Solanum peruvianum 17.7 kDa class I heat shock protein

Sign In for Pricing
View Details