NIN Rabbit pAb (APR28045N)
Product Specifications
Background
This gene encodes one of the proteins important for centrosomal function. This protein is important for positioning and anchoring the microtubules minus-ends in epithelial cells. Localization of this protein to the centrosome requires three leucine zippers in the central coiled-coil domain. Multiple alternatively spliced transcript variants that encode different isoforms have been reported.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NIN Rabbit pAb (APR28045N) .
Synonyms
NIN; SCKL7; ninein
Gene ID
51199
UniProt
Q8N4C6
Cellular Locus
Cytoplasm, centrosome, cytoskeleton, microtubule organizing center
Applications
IF (Human, Homo sapiens) WB (Homo sapiens)
Dilution
WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:50 - 1:100
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 147kDa/160kDa/236-248kDa Observed MW: 190kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51199
Uniprot URL
https://www.uniprot.org/uniprot/Q8N4C6
AA Sequence
MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEALILILSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQESVEEFPEVTVIEPLDEEARPSHIPAGDCSEHWKTQRSEEYEAEGQLRFWNPDDLNASQSGSSPPQDWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQNVDGEMLEEVFHNLDPDGTMSVEDFFYGLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRTTTSSAMT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6488841-01 0.1 mL
MyD88 (Myeloid Differentiation Marker 88, Myeloid Differentiation Primary Response Gene, Myeloid Differentiation Primary Response Protein MyD88) (AP)
Sign In for Pricing
View Details MBS6488841-02 5x 0.1 mL
MyD88 (Myeloid Differentiation Marker 88, Myeloid Differentiation Primary Response Gene, Myeloid Differentiation Primary Response Protein MyD88) (AP)
Sign In for Pricing
View Details 
MBS6250634-01 0.1 mL
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)
Sign In for Pricing
View Details MBS6250634-02 5x 0.1 mL
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)
Sign In for Pricing
View Details