Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK38 Rabbit pAb (APR28026N)

Product Specifications

Background

This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STK38 Rabbit pAb (APR28026N) .

Synonyms

STK38; NDR; NDR1

Gene ID

11329

UniProt

Q15208

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 54kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11329

Uniprot URL

https://www.uniprot.org/uniprot/Q15208

AA Sequence

MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Ankyrin repeat domain containing protein 36B (ANKRD36B) ELISA Kit
GTR10334447 96 Well

Rabbit Ankyrin repeat domain containing protein 36B (ANKRD36B) ELISA Kit

Sign In for Pricing
View Details
Mouse Annexin A1 (ANXA1) ELISA Kit
orb2667174-01 48 Tests

Mouse Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Annexin A1 (ANXA1) ELISA Kit
orb2667174-02 96 Tests

Mouse Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
CheKine™ Mirco Triose-Phosphate Isomerase (TPI) Activity Assay Kit
KTB1128-01 48 Tests - 48 Samples

CheKine™ Mirco Triose-Phosphate Isomerase (TPI) Activity Assay Kit

Sign In for Pricing
View Details
CheKine™ Mirco Triose-Phosphate Isomerase (TPI) Activity Assay Kit
KTB1128-02 96 Tests - 96 Samples

CheKine™ Mirco Triose-Phosphate Isomerase (TPI) Activity Assay Kit

Sign In for Pricing
View Details
Mouse Monoclonal ChABC Antibody (6A12) [Alexa Fluor 532]
NBP1-96142AF532 0.1 mL

Mouse Monoclonal ChABC Antibody (6A12) [Alexa Fluor 532]

Sign In for Pricing
View Details