Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGR1 Rabbit pAb (APR28015N)

Product Specifications

Background

This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYNGR1 Rabbit pAb (APR28015N) .

Synonyms

SYNGR1

Gene ID

9145

UniProt

O43759

Cellular Locus

Cell junction, Melanosome, Membrane, Multi-pass membrane protein, synapse

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/25kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9145

Uniprot URL

https://www.uniprot.org/uniprot/O43759

AA Sequence

MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PXK sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38236111 3x 1.0 µg

PXK sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Toxoplasma IgM ELISA Kit
MBS580125-01 96 Tests

Toxoplasma IgM ELISA Kit

Sign In for Pricing
View Details
Toxoplasma IgM ELISA Kit
MBS580125-02 5x 96 Tests

Toxoplasma IgM ELISA Kit

Sign In for Pricing
View Details
Toxoplasma IgM ELISA Kit
MBS580125-03 10x 96 Tests

Toxoplasma IgM ELISA Kit

Sign In for Pricing
View Details
Angiopoietin Like Protein 2 (Biotin)
545063 200 µL

Angiopoietin Like Protein 2 (Biotin)

Sign In for Pricing
View Details
EP2 (PTGER2) (NM_000956) Human Tagged ORF Clone
RC210883 10 µg

EP2 (PTGER2) (NM_000956) Human Tagged ORF Clone

Sign In for Pricing
View Details