Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGR1 Rabbit pAb (APR28015N)

Product Specifications

Background

This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYNGR1 Rabbit pAb (APR28015N) .

Synonyms

SYNGR1

Gene ID

9145

UniProt

O43759

Cellular Locus

Cell junction, Melanosome, Membrane, Multi-pass membrane protein, synapse

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/25kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9145

Uniprot URL

https://www.uniprot.org/uniprot/O43759

AA Sequence

MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SOD1/Cu-Zn SOD Antibody [DyLight 488]
NBP2-24915G 0.1 mL

Rabbit Polyclonal SOD1/Cu-Zn SOD Antibody [DyLight 488]

Sign In for Pricing
View Details
Rat Monoclonal Siglec-1/CD169 Antibody (645608) [DyLight 680]
FAB5610Y 0.1 mL

Rat Monoclonal Siglec-1/CD169 Antibody (645608) [DyLight 680]

Sign In for Pricing
View Details
TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF (II) 55, TAFII-55) (Biotin)
134195-Biotin 100 µL

TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF (II) 55, TAFII-55) (Biotin)

Sign In for Pricing
View Details
Quinone oxidoReductase (CRYZ) Bovine ELISA Kit
G6000 96 Tests

Quinone oxidoReductase (CRYZ) Bovine ELISA Kit

Sign In for Pricing
View Details
PCDHA4 (Protocadherin Alpha 4)
488187 100 µL

PCDHA4 (Protocadherin Alpha 4)

Sign In for Pricing
View Details
Olfr608 Mouse siRNA Oligo Duplex (Locus ID 258751)
SR410283 1 Kit

Olfr608 Mouse siRNA Oligo Duplex (Locus ID 258751)

Sign In for Pricing
View Details