Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN8 Rabbit pAb (APR28014N)

Product Specifications

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This protein plays important roles in the paracellular cation barrier of the distal renal tubule, and in the paracellular barrier to prevent sodium back-leakage in distal colon. Differential expression of this gene has been observed in colorectal carcinoma and renal cell tumors, and along with claudin-7, is an immunohistochemical marker for the differential diagnosis of chromophobe renal cell carcinoma and renal oncocytoma.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CLDN8 Rabbit pAb (APR28014N) .

Synonyms

CLDN8; HEL-S-79; claudin-8

Gene ID

9073

UniProt

P56748

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, tight junction

Applications

WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9073

Uniprot URL

https://www.uniprot.org/uniprot/P56748

AA Sequence

QWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem47 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3635803 1.0 µg DNA

Tmem47 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila rimP Protein
VAng-Lsx0924-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Hydrophila rimP Protein

Sign In for Pricing
View Details
Chicken Choline kinase Alpha (CHKA) ELISA kit
GTR10445832 96 Well

Chicken Choline kinase Alpha (CHKA) ELISA kit

Sign In for Pricing
View Details
TTI1 (F-6)
sc-271851 200 µg/mL

TTI1 (F-6)

Sign In for Pricing
View Details
Rabbit Polyclonal Ceruloplasmin Antibody
NBP1-88116 0.1 mL

Rabbit Polyclonal Ceruloplasmin Antibody

Sign In for Pricing
View Details
Peroxiredoxin 2 monoclonal antibody
orb1722924-01 50 µL

Peroxiredoxin 2 monoclonal antibody

Sign In for Pricing
View Details