Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VNN2 Rabbit pAb (APR28012N)

Product Specifications

Background

This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. The encoded protein is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. This gene lies in close proximity to, and in same transcriptional orientation as two other vanin genes on chromosome 6q23-q24. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VNN2 Rabbit pAb (APR28012N) .

Synonyms

VNN2; FOAP-4; GPI-80; vanin 2

Gene ID

8875

UniProt

O95498

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/21kDa/33kDa/52kDa/58kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8875

Uniprot URL

https://www.uniprot.org/uniprot/O95498

AA Sequence

VSLNMTGSGIYAPNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTMLKCKTTNLTTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGR1 (Early Growth Response 1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225) (MaxLight 550)
MBS6216657-01 0.1 mL

EGR1 (Early Growth Response 1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225) (MaxLight 550)

Sign In for Pricing
View Details
EGR1 (Early Growth Response 1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225) (MaxLight 550)
MBS6216657-02 5x 0.1 mL

EGR1 (Early Growth Response 1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human PTTG1IP shRNA (UAS) - Lentiviral human PTTG1IP shRNA (UAS) plasmid
GTR15306418 1 Vial

Lentiviral human PTTG1IP shRNA (UAS) - Lentiviral human PTTG1IP shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human F-box only protein 21 (FBXO21) ELISA Kit
abx523617 96 Tests

Human F-box only protein 21 (FBXO21) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal CEACAM6/CD66c Antibody (111) [Janelia Fluor 549]
NBP2-89672JF549 0.1 mL

Rabbit Monoclonal CEACAM6/CD66c Antibody (111) [Janelia Fluor 549]

Sign In for Pricing
View Details
Ddc (NM_001190448) Mouse Tagged ORF Clone
MR226067 10 µg

Ddc (NM_001190448) Mouse Tagged ORF Clone

Sign In for Pricing
View Details