Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VNN2 Rabbit pAb (APR28012N)

Product Specifications

Background

This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. The encoded protein is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. This gene lies in close proximity to, and in same transcriptional orientation as two other vanin genes on chromosome 6q23-q24. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VNN2 Rabbit pAb (APR28012N) .

Synonyms

VNN2; FOAP-4; GPI-80; vanin 2

Gene ID

8875

UniProt

O95498

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/21kDa/33kDa/52kDa/58kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8875

Uniprot URL

https://www.uniprot.org/uniprot/O95498

AA Sequence

VSLNMTGSGIYAPNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTMLKCKTTNLTTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6740507 1.0 µg DNA

Tsc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TLK2 Protein Vector (Human) (pPM-C-His)
PV042244 500 ng

TLK2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CTNNA2 Protein Vector (Mouse) (pPB-N-His)
PV168727 500 ng

CTNNA2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
DCN sgRNA CRISPR Lentivector set (Human)
K0566201 3x 1.0 µg

DCN sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Molybdenum import ATP-binding protein ModC (modC)
MBS1481461-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Molybdenum import ATP-binding protein ModC (modC)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Molybdenum import ATP-binding protein ModC (modC)
MBS1481461-02 0.02 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua Molybdenum import ATP-binding protein ModC (modC)

Sign In for Pricing
View Details