Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCB2 Rabbit pAb (APR27989N)

Product Specifications

Background

The protein encoded by this gene is a phosphodiesterase that catalyzes the hydrolysis of phosphatidylinositol 4,5-bisphosphate to the second messengers inositol 1,4,5-trisphosphate (IP3) and diacylglycerol. The encoded protein is activated by G proteins and has been shown to be involved in the type 2 taste receptor signal transduction pathway. In addition, nuclear factor kappa B can regulate the transcription of this gene, whose protein product is also an important regulator of platelet responses.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PLCB2 Rabbit pAb (APR27989N) .

Synonyms

PLCB2; PLC-beta-2

Gene ID

5330

UniProt

Q00722

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 132kDa/133kDa/134kDa Observed MW: 140KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5330

Uniprot URL

https://www.uniprot.org/uniprot/Q00722

AA Sequence

MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKENVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKPGGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS705952 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
ZNF440 Human Gene Knockout Kit (CRISPR)
KN419424 1 Kit

ZNF440 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (2C3), CF594 conjugate, 0.1mg/mL
BNC941764-100 1x 100 µL

MMP9 (Matrix Metalloproteinase 9) (2C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-(Chloromercuri)benzenesulfonic Acid Sodium Salt
TRC-C367750-50MG 50 mg

4-(Chloromercuri)benzenesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
Human ANKAR activation kit by CRISPRa
GA115764 1 Kit

Human ANKAR activation kit by CRISPRa

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF594 conjugate, 0.1mg/mL
BNC942309-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details