Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] OXCT1 Rabbit pAb (APR27987N)

Product Specifications

Background

This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] OXCT1 Rabbit pAb (APR27987N) .

Synonyms

OXCT1; OXCT; SCOT

Gene ID

5019

UniProt

P55809

Cellular Locus

Mitochondrion matrix

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/56kDa Observed MW: 56kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5019

Uniprot URL

https://www.uniprot.org/uniprot/P55809

AA Sequence

IPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CD5L Antibody [mFluor Violet 610 SE]
NBP1-76699MFV610 0.1 mL

Rabbit Polyclonal CD5L Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
CCDC149 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0386905 3x 1.0 µg

CCDC149 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal Sodium Potassium ATPase Alpha 1 Antibody (464.6) [PerCP]
NBP2-61137PCP 0.1 mL

Mouse Monoclonal Sodium Potassium ATPase Alpha 1 Antibody (464.6) [PerCP]

Sign In for Pricing
View Details
HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 550)
MBS6215520-01 0.1 mL

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 550)

Sign In for Pricing
View Details
HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 550)
MBS6215520-02 5x 0.1 mL

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 550)

Sign In for Pricing
View Details
CB2 Rabbit Polyclonal Antibody
E53P02498 100 µL

CB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details