Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD6 Rabbit pAb (APR27963N)

Product Specifications

Background

This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis (PMID: 19525953, 21849685) . Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD6 Rabbit pAb (APR27963N) .

Synonyms

CD6; TP120

Gene ID

923

UniProt

P30203

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 58kDa/60kDa/63kDa/64kDa/68kDa/71kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=923

Uniprot URL

https://www.uniprot.org/uniprot/P30203

AA Sequence

LRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPPNLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDISAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFIIA2 (GTF2A2) Rabbit Polyclonal Antibody
TA370444 100 µL

TFIIA2 (GTF2A2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Advanced Blue Transill µminator 470nm, White Light, Viewing area 153x153 mm
MBE-200BW 1 Unit

Advanced Blue Transill µminator 470nm, White Light, Viewing area 153x153 mm

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS502545 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Tnfrsf13b Mouse Gene Knockout Kit (CRISPR)
KN517977 1 Kit

Tnfrsf13b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS631522 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
NOXO1 (NM_144603) Human Over-expression Lysate
LY403398 100 µg

NOXO1 (NM_144603) Human Over-expression Lysate

Sign In for Pricing
View Details