Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF3 Rabbit pAb (APR27957N)

Product Specifications

Background

ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2, and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARF3 Rabbit pAb (APR27957N) .

Synonyms

ARF3

Gene ID

377

UniProt

P61204

Cellular Locus

Cytoplasm, Golgi apparatus, perinuclear region

Dilution

IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=377

Uniprot URL

https://www.uniprot.org/uniprot/P61204

AA Sequence

MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RNK rabbit pAb
RA29508-01 50 µL

RNK rabbit pAb

Ask
View Details
RNK rabbit pAb
RA29508-02 100 µL

RNK rabbit pAb

Ask
View Details
Ep-CAM (CD326, Adenocarcinoma-Associated Antigen, Cell Surface GlycoProtein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial GlycoProtein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-Associated Calcium Signal Transducer 1) discontinued
172088-01 100 µL

Ep-CAM (CD326, Adenocarcinoma-Associated Antigen, Cell Surface GlycoProtein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial GlycoProtein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-Associated Calcium Signal Transducer 1) discontinued

Ask
View Details
Ep-CAM (CD326, Adenocarcinoma-Associated Antigen, Cell Surface GlycoProtein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial GlycoProtein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-Associated Calcium Signal Transducer 1) discontinued
172088-02 500 µL

Ep-CAM (CD326, Adenocarcinoma-Associated Antigen, Cell Surface GlycoProtein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial GlycoProtein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-Associated Calcium Signal Transducer 1) discontinued

Ask
View Details
Ep-CAM (CD326, Adenocarcinoma-Associated Antigen, Cell Surface GlycoProtein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial GlycoProtein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-Associated Calcium Signal Transducer 1) discontinued
172088-03 1 mL

Ep-CAM (CD326, Adenocarcinoma-Associated Antigen, Cell Surface GlycoProtein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial GlycoProtein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-Associated Calcium Signal Transducer 1) discontinued

Ask
View Details
Arjunolic Acid
TRC-A779000-50MG 50 mg

Arjunolic Acid

Ask
View Details