Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHKB Rabbit pAb (APR27899N)

Product Specifications

Background

Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, encoded by two different genes. The beta subunit is the same in both the muscle and hepatic isoforms, encoded by this gene, which is a member of the phosphorylase b kinase regulatory subunit family. The gamma subunit also includes the skeletal muscle and hepatic isoforms, encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9B, also known as phosphorylase kinase deficiency of liver and muscle. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. Two pseudogenes have been found on chromosomes 14 and 20, respectively.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PHKB Rabbit pAb (APR27899N) .

Synonyms

PHKB

Gene ID

5257

UniProt

Q93100

Cellular Locus

Cell membrane, Cytoplasmic side, Lipid-anchor

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 123kDa/124kDa Observed MW: 125kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5257

Uniprot URL

https://www.uniprot.org/uniprot/Q93100

AA Sequence

VIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLYQLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAGKHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQDKVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEGEVKPNNDDPCLIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFGEF3 siRNA (Human)
CRJ1403-01 15 nmol

ARFGEF3 siRNA (Human)

Sign In for Pricing
View Details
ARFGEF3 siRNA (Human)
CRJ1403-02 30 nmol

ARFGEF3 siRNA (Human)

Sign In for Pricing
View Details
TPOR (MPL) (NM_005373) Human Tagged Lenti ORF Clone
RC224901L3 10 µg

TPOR (MPL) (NM_005373) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MLL2, CT (KMT2B) (MaxLight 550) discontinued
038475-ML550 100 µL

MLL2, CT (KMT2B) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PLV3-U6-MDC1 (human) -shRNA1-Puro
BZ56906 1 Vial

PLV3-U6-MDC1 (human) -shRNA1-Puro

Sign In for Pricing
View Details
Anti-Creatine Kinase, Muscle (CKM) Monoclonal Antibody
CAU36245-01 100 µL

Anti-Creatine Kinase, Muscle (CKM) Monoclonal Antibody

Sign In for Pricing
View Details