Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] NDUFS3 Rabbit pAb (APR27898N)

Product Specifications

Background

This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I) . Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] NDUFS3 Rabbit pAb (APR27898N) .

Synonyms

NDUFS3; CI-30

Gene ID

4722

UniProt

O75489

Cellular Locus

Mitochondrion inner membrane

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/30kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4722

Uniprot URL

https://www.uniprot.org/uniprot/O75489

AA Sequence

ESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Intact Fibroblast Growth Factor 23 ELISA Kit
MBS3804903-01 48 Well

Human Intact Fibroblast Growth Factor 23 ELISA Kit

Sign In for Pricing
View Details
Human Intact Fibroblast Growth Factor 23 ELISA Kit
MBS3804903-02 96 Well

Human Intact Fibroblast Growth Factor 23 ELISA Kit

Sign In for Pricing
View Details
Human Intact Fibroblast Growth Factor 23 ELISA Kit
MBS3804903-03 5x 96 Well

Human Intact Fibroblast Growth Factor 23 ELISA Kit

Sign In for Pricing
View Details
Human Intact Fibroblast Growth Factor 23 ELISA Kit
MBS3804903-04 10x 96 Well

Human Intact Fibroblast Growth Factor 23 ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal HFE Antibody (SR1669)
NBP3-22456-100ul 100 µL

Rabbit Monoclonal HFE Antibody (SR1669)

Sign In for Pricing
View Details
TICAM2 (TIRAP3, TIRP, TRAM, TIR Domain-containing Adapter Molecule 2, Putative NF-kappa-B-activating Protein 502, TRIF-related Adapter Molecule, Toll-like Receptor Adaptor Protein 3, Toll/Interleukin-1 Receptor Domain-containing Protein, MGC129876, MGC129
MBS6396532-01 0.1 mL

TICAM2 (TIRAP3, TIRP, TRAM, TIR Domain-containing Adapter Molecule 2, Putative NF-kappa-B-activating Protein 502, TRIF-related Adapter Molecule, Toll-like Receptor Adaptor Protein 3, Toll/Interleukin-1 Receptor Domain-containing Protein, MGC129876, MGC129

Sign In for Pricing
View Details