Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] NDUFS3 Rabbit pAb (APR27898N)

Product Specifications

Background

This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I) . Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] NDUFS3 Rabbit pAb (APR27898N) .

Synonyms

NDUFS3; CI-30

Gene ID

4722

UniProt

O75489

Cellular Locus

Mitochondrion inner membrane

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/30kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4722

Uniprot URL

https://www.uniprot.org/uniprot/O75489

AA Sequence

ESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HOXA7 sgRNA gene knockout kit - Lentiviral human HOXA7 sgRNA gene knockout kit (25)
GTR15376815 1 Vial

Lentiviral human HOXA7 sgRNA gene knockout kit - Lentiviral human HOXA7 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MTF2, ID (MTF2, PCL2, Metal-response element-binding transcription factor 2, Metal regulatory transcription factor 2, Metal-response element DNA-binding protein M96, Polycomb-like protein 2)
038652 200 µL

MTF2, ID (MTF2, PCL2, Metal-response element-binding transcription factor 2, Metal regulatory transcription factor 2, Metal-response element DNA-binding protein M96, Polycomb-like protein 2)

Sign In for Pricing
View Details
Anti-Human CD114/CSF3R Antibody (SAA0042), APC
FHJ42813 100 Tests

Anti-Human CD114/CSF3R Antibody (SAA0042), APC

Sign In for Pricing
View Details
Recombinant Boa constrictor Brain-derived neurotrophic factor (BDNF)
MBS1420732-01 0.02 mg (E-Coli)

Recombinant Boa constrictor Brain-derived neurotrophic factor (BDNF)

Sign In for Pricing
View Details
Recombinant Boa constrictor Brain-derived neurotrophic factor (BDNF)
MBS1420732-02 0.1 mg (E-Coli)

Recombinant Boa constrictor Brain-derived neurotrophic factor (BDNF)

Sign In for Pricing
View Details
Recombinant Boa constrictor Brain-derived neurotrophic factor (BDNF)
MBS1420732-03 0.02 mg (Yeast)

Recombinant Boa constrictor Brain-derived neurotrophic factor (BDNF)

Sign In for Pricing
View Details