Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG9A Rabbit pAb (APR27880N)

Product Specifications

Background

Phospholipid scramblase involved in autophagy by mediating autophagosomal membrane expansion. Cycles between the preautophagosomal structure/phagophore assembly site (PAS and the cytoplasmic vesicle pool and supplies membrane for the growing autophagosome. Lipid scramblase activity plays a key role in preautophagosomal structure/phagophore assembly by distributing the phospholipids that arrive through ATG2 (ATG2A or ATG2B from the cytoplasmic to the luminal leaflet of the bilayer, thereby driving autophagosomal membrane expansion. Also required to supply phosphatidylinositol 4-phosphate to the autophagosome initiation site by recruiting the phosphatidylinositol 4-kinase beta (PI4KB in a process dependent on ARFIP2, but not ARFIP1. In addition to autophagy, also plays a role in necrotic cell death (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATG9A Rabbit pAb (APR27880N) .

Synonyms

ATG9A; APG9L1; MGD3208; mATG9

Gene ID

79065

UniProt

Q7Z3C6

Cellular Locus

Cytoplasmic vesicle, Endoplasmic reticulum membrane, Golgi apparatus, Late endosome membrane, Multi-pass membrane protein, autophagosome membrane, trans-Golgi network membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 60kDa/87kDa/94kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79065

Uniprot URL

https://www.uniprot.org/uniprot/Q7Z3C6

AA Sequence

WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTFE Stirrer Guides Universal (V7) B Length Cone Shaft 10 Cone 24/29 Ht 96 Guide dia. 45
52057 1 Each

PTFE Stirrer Guides Universal (V7) B Length Cone Shaft 10 Cone 24/29 Ht 96 Guide dia. 45

Sign In for Pricing
View Details
GNG2 Rabbit pAb
MBS8547845-01 0.1 mL

GNG2 Rabbit pAb

Sign In for Pricing
View Details
GNG2 Rabbit pAb
MBS8547845-02 0.1 mL (AF405L)

GNG2 Rabbit pAb

Sign In for Pricing
View Details
GNG2 Rabbit pAb
MBS8547845-03 0.1 mL (AF405S)

GNG2 Rabbit pAb

Sign In for Pricing
View Details
GNG2 Rabbit pAb
MBS8547845-04 0.1 mL (AF610)

GNG2 Rabbit pAb

Sign In for Pricing
View Details
GNG2 Rabbit pAb
MBS8547845-05 0.1 mL (AF635)

GNG2 Rabbit pAb

Sign In for Pricing
View Details