Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4F12 Rabbit pAb (APR27879N)

Product Specifications

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid. It can also catalyze the epoxidation of 22:6n-3 and 22:5n-3 polyunsaturated long-chain fatty acids. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYP4F12 Rabbit pAb (APR27879N) .

Synonyms

CYP4F12; CYPIVF12; F22329_1

Gene ID

66002

UniProt

Q9HCS2

Cellular Locus

Endoplasmic reticulum membrane, Microsome membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa/60kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=66002

Uniprot URL

https://www.uniprot.org/uniprot/Q9HCS2

AA Sequence

DFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CRBN Antibody [FITC]
NBP2-82079F 0.1 mL

Rabbit Polyclonal CRBN Antibody [FITC]

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRK34 Polyclonal Antibody
MBS9003303 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRK34 Polyclonal Antibody

Sign In for Pricing
View Details
BCAR1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-6223R-APC-Cy7 100 µL

BCAR1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
PGR discontinued
328090 100 µL

PGR discontinued

Sign In for Pricing
View Details
Urocortin II, Human
MBS826275-01 1 mg

Urocortin II, Human

Sign In for Pricing
View Details
Urocortin II, Human
MBS826275-02 5 mg

Urocortin II, Human

Sign In for Pricing
View Details