Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4F12 Rabbit pAb (APR27879N)

Product Specifications

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid. It can also catalyze the epoxidation of 22:6n-3 and 22:5n-3 polyunsaturated long-chain fatty acids. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYP4F12 Rabbit pAb (APR27879N) .

Synonyms

CYP4F12; CYPIVF12; F22329_1

Gene ID

66002

UniProt

Q9HCS2

Cellular Locus

Endoplasmic reticulum membrane, Microsome membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa/60kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=66002

Uniprot URL

https://www.uniprot.org/uniprot/Q9HCS2

AA Sequence

DFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenolphthalein (0.04% Solution in Ethanol)
TRC-P318011-100ML 100 mL

Phenolphthalein (0.04% Solution in Ethanol)

Sign In for Pricing
View Details
CD157 Blocking Peptide
MBS824435-01 1 mg

CD157 Blocking Peptide

Sign In for Pricing
View Details
CD157 Blocking Peptide
MBS824435-02 5 mg

CD157 Blocking Peptide

Sign In for Pricing
View Details
CD157 Blocking Peptide
MBS824435-03 5x 5 mg

CD157 Blocking Peptide

Sign In for Pricing
View Details
HSPA1B ELISA Kit (Mouse) (OKCA01685)
OKCA01685 96 Well

HSPA1B ELISA Kit (Mouse) (OKCA01685)

Sign In for Pricing
View Details
Mouse beta cellulin, BTC ELISA Kit
YLA0778MO-01 48 Tests

Mouse beta cellulin, BTC ELISA Kit

Sign In for Pricing
View Details