Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG7 Rabbit pAb (APR27875N)

Product Specifications

Background

The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP) . TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CACNG7 Rabbit pAb (APR27875N) .

Synonyms

CACNG7

Gene ID

59284

UniProt

P62955

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=59284

Uniprot URL

https://www.uniprot.org/uniprot/P62955

AA Sequence

INDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolin 3 (CAV3) (NM_033337) Human Tagged ORF Clone Lentiviral Particle
RC221140L1V 200 µL

Caveolin 3 (CAV3) (NM_033337) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA Kit
MBS4500847-01 48 Tests

Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA Kit

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA Kit
MBS4500847-02 96 Tests

Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA Kit

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA Kit
MBS4500847-03 5x 96 Tests

Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA Kit

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA Kit
MBS4500847-04 10x 96 Tests

Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA Kit

Sign In for Pricing
View Details
anti-ACSM3
YF-PA14507 50 ug

anti-ACSM3

Sign In for Pricing
View Details