Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLGN4X Rabbit pAb (APR27872N)

Product Specifications

Background

This gene encodes a member of the type-B carboxylesterase/lipase protein family. The encoded protein belongs to a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs large homolog 4 (DLG4) . Mutations in this gene have been associated with autism and Asperger syndrome. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NLGN4X Rabbit pAb (APR27872N) .

Synonyms

NLGN4X; ASPGX2; AUTSX2; HLNX; HNL4X; NLGN4; neuroligin-4; X-linked

Gene ID

57502

UniProt

Q8N0W4

Cellular Locus

Cell junction, Cell membrane, Single-pass type I membrane protein, postsynaptic cell membrane, postsynaptic density, synapse

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 91kDa/94kDa Observed MW: 92kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57502

Uniprot URL

https://www.uniprot.org/uniprot/Q8N0W4

AA Sequence

YYKKDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCX2 (NM_016378) Human Recombinant Protein
TP313997L 1 mg

VCX2 (NM_016378) Human Recombinant Protein

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (SK3), CF®660C Conjugate - Biotium Choice
P001-660C-500 1x 500 µL

CD4 Mouse Monoclonal Antibody (SK3), CF®660C Conjugate - Biotium Choice

Sign In for Pricing
View Details
α, ω-Bis-Pyridyldithio PEG
113000-44.5G 5 g

α, ω-Bis-Pyridyldithio PEG

Sign In for Pricing
View Details
APEH Polyclonal Antibody
E-AB-12756-01 20 µL

APEH Polyclonal Antibody

Sign In for Pricing
View Details
APEH Polyclonal Antibody
E-AB-12756-02 60 µL

APEH Polyclonal Antibody

Sign In for Pricing
View Details
APEH Polyclonal Antibody
E-AB-12756-03 120 µL

APEH Polyclonal Antibody

Sign In for Pricing
View Details