Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT4H1 Rabbit pAb (APR27829N)

Product Specifications

Background

This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SUPT4H1 Rabbit pAb (APR27829N) .

Synonyms

SUPT4H1; SPT4; SPT4H; SUPT4H; Supt4a

Gene ID

6827

UniProt

P63272

Cellular Locus

Nucleus

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6827

Uniprot URL

https://www.uniprot.org/uniprot/P63272

AA Sequence

MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Coagulation Factor VII Antibody (121) [Alexa Fluor 488]
NBP2-90369AF488 0.1 mL

Rabbit Monoclonal Coagulation Factor VII Antibody (121) [Alexa Fluor 488]

Sign In for Pricing
View Details
Lentiviral human ABL2 shRNA (UAS) - Lentiviral human ABL2 shRNA (UAS, GFP) (25)
GTR15330227 1 Vial

Lentiviral human ABL2 shRNA (UAS) - Lentiviral human ABL2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Factor VII heavy chain Polyclonal Antibody, APC Conjugated
bs-4846R-APC 100 µL

Factor VII heavy chain Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Bacillus cereus (MYP) Agar
MED1158 10 / PCK

Bacillus cereus (MYP) Agar

Sign In for Pricing
View Details
TCP1 beta/CCT2 Rabbit pAb (APR26623N)
APR26623N-01 50 µL

TCP1 beta/CCT2 Rabbit pAb (APR26623N)

Sign In for Pricing
View Details
TCP1 beta/CCT2 Rabbit pAb (APR26623N)
APR26623N-02 100 µL

TCP1 beta/CCT2 Rabbit pAb (APR26623N)

Sign In for Pricing
View Details