Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT4H1 Rabbit pAb (APR27829N)

Product Specifications

Background

This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SUPT4H1 Rabbit pAb (APR27829N) .

Synonyms

SUPT4H1; SPT4; SPT4H; SUPT4H; Supt4a

Gene ID

6827

UniProt

P63272

Cellular Locus

Nucleus

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6827

Uniprot URL

https://www.uniprot.org/uniprot/P63272

AA Sequence

MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pou2af1 Pre-designed siRNA Set A
SI110932A 1 Each

Mouse Pou2af1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
OriCell™ Complete Medium For KPC Cell Line
CMM1-1001 500 mL

OriCell™ Complete Medium For KPC Cell Line

Sign In for Pricing
View Details
Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]
CL007A 1 mg

Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]

Sign In for Pricing
View Details
Rat SFRP4 (Secreted Frizzled Related Protein 4) ELISA Kit
ER22051 96 Tests

Rat SFRP4 (Secreted Frizzled Related Protein 4) ELISA Kit

Sign In for Pricing
View Details
Insert for 130mm box for 5x5=25 tubes 15ml
TE22151 36 Cases

Insert for 130mm box for 5x5=25 tubes 15ml

Sign In for Pricing
View Details
S100 Calcium Binding Protein A13 (S100A13) (NM_001024212) Human Tagged ORF Clone
RC218914 10 µg

S100 Calcium Binding Protein A13 (S100A13) (NM_001024212) Human Tagged ORF Clone

Sign In for Pricing
View Details