Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT4H1 Rabbit pAb (APR27829N)

Product Specifications

Background

This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SUPT4H1 Rabbit pAb (APR27829N) .

Synonyms

SUPT4H1; SPT4; SPT4H; SUPT4H; Supt4a

Gene ID

6827

UniProt

P63272

Cellular Locus

Nucleus

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6827

Uniprot URL

https://www.uniprot.org/uniprot/P63272

AA Sequence

MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Antibody
abx104701-01 100 µL

Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Antibody
abx104701-02 200 µL

Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Antibody
abx104701-03 1 mL

Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) Antibody

Sign In for Pricing
View Details
Sox13 Rat shRNA Lentiviral Particle (Locus ID 289026)
TL704547V 500 µL Each

Sox13 Rat shRNA Lentiviral Particle (Locus ID 289026)

Sign In for Pricing
View Details
COX16 discontinued
387750 200 µL

COX16 discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Cyclin D1 Antibody (SPM587) [DyLight 405]
NBP2-34816V 0.1 mL

Mouse Monoclonal Cyclin D1 Antibody (SPM587) [DyLight 405]

Sign In for Pricing
View Details