Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A3 Rabbit pAb (APR27828N)

Product Specifications

Background

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Read-through transcription exists between this gene and the upstream SLX1A (SLX1 structure-specific endonuclease subunit homolog A) gene that encodes a protein containing GIY-YIG domains.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SULT1A3 Rabbit pAb (APR27828N) .

Synonyms

SULT1A3; HAST; HAST3; M-PST; ST1A3; ST1A3/ST1A4; ST1A5; STM; TL-PST

Gene ID

6818

UniProt

P0DMM9

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 34kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6818

Uniprot URL

https://www.uniprot.org/uniprot/P0DMM9

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)
MBS1249075-01 0.02 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)
MBS1249075-02 0.02 mg (Yeast)

Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)
MBS1249075-03 0.1 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)
MBS1249075-04 0.1 mg (Yeast)

Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)
MBS1249075-05 0.02 mg (Baculovirus)

Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)
MBS1249075-06 0.02 mg (Mammalian-Cell)

Recombinant Cryptococcus neoformans var. neoformans serotype D Eukaryotic translation initiation factor 3 subunit I (TIF34)

Sign In for Pricing
View Details