Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX4 Rabbit pAb (APR27825N)

Product Specifications

Background

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t (X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SSX4 Rabbit pAb (APR27825N) .

Synonyms

SSX4; CT5.4

Gene ID

6759

UniProt

O60224

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/21kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6759

Uniprot URL

https://www.uniprot.org/uniprot/O60224

AA Sequence

FMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STIP1 3'UTR Lenti-reporter-Luc Vector
45726081 1.0 µg

STIP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Mouse GLI Family Zinc Finger Protein 3 (GLI3)
RPU41602-01 50 µg

Recombinant Mouse GLI Family Zinc Finger Protein 3 (GLI3)

Sign In for Pricing
View Details
Recombinant Mouse GLI Family Zinc Finger Protein 3 (GLI3)
RPU41602-02 100 µg

Recombinant Mouse GLI Family Zinc Finger Protein 3 (GLI3)

Sign In for Pricing
View Details
Recombinant Mouse GLI Family Zinc Finger Protein 3 (GLI3)
RPU41602-03 1 mg

Recombinant Mouse GLI Family Zinc Finger Protein 3 (GLI3)

Sign In for Pricing
View Details
Recombinant Mouse ANGEL2 Protein, His (Fc)-Avi-tagged
ANGEL2-528M 50 µg

Recombinant Mouse ANGEL2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SNF2H (human), (recombinant)
ENZ-PRT335-0050 50 μL

SNF2H (human), (recombinant)

Sign In for Pricing
View Details