Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORT1 Rabbit pAb (APR27822N)

Product Specifications

Background

This gene encodes a member of the VPS10-related sortilin family of proteins. The encoded preproprotein is proteolytically processed by furin to generate the mature receptor. This receptor plays a role in the trafficking of different proteins to either the cell surface, or subcellular compartments such as lysosomes and endosomes. Expression levels of this gene may influence the risk of myocardial infarction in human patients. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SORT1 Rabbit pAb (APR27822N) .

Synonyms

SORT1; Gp95; LDLCQ6; NT3; NTR3; sortilin

Gene ID

6272

UniProt

Q99523

Cellular Locus

Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Extracellular side, Golgi apparatus, Golgi stack membrane, Lysosome membrane, Membrane, Nucleus membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa/92kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6272

Uniprot URL

https://www.uniprot.org/uniprot/Q99523

AA Sequence

EGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPII

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PRKAB1 (Protein Kinase, AMP-activated, beta 1 non-Catalytic Subunit, 5'-AMP-activated Protein Kinase beta-1 Subunit, AMP-activated Protein Kinase beta 1 non-Catalytic Subunit, AMP-activated Protein Kinase beta Subunit, AMPK beta -1 Chain, AMPK beta 1, Pro
MBS6215608-01 0.1 mL

PRKAB1 (Protein Kinase, AMP-activated, beta 1 non-Catalytic Subunit, 5'-AMP-activated Protein Kinase beta-1 Subunit, AMP-activated Protein Kinase beta 1 non-Catalytic Subunit, AMP-activated Protein Kinase beta Subunit, AMPK beta -1 Chain, AMPK beta 1, Pro

Ask
View Details
PRKAB1 (Protein Kinase, AMP-activated, beta 1 non-Catalytic Subunit, 5'-AMP-activated Protein Kinase beta-1 Subunit, AMP-activated Protein Kinase beta 1 non-Catalytic Subunit, AMP-activated Protein Kinase beta Subunit, AMPK beta -1 Chain, AMPK beta 1, Pro
MBS6215608-02 5x 0.1 mL

PRKAB1 (Protein Kinase, AMP-activated, beta 1 non-Catalytic Subunit, 5'-AMP-activated Protein Kinase beta-1 Subunit, AMP-activated Protein Kinase beta 1 non-Catalytic Subunit, AMP-activated Protein Kinase beta Subunit, AMPK beta -1 Chain, AMPK beta 1, Pro

Ask
View Details
Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody
TA367192 100 µL

Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Bacillus amyloliquefaciens Thiamine-phosphate synthase (thiE)
MBS1097345-01 0.02 mg (E-Coli)

Recombinant Bacillus amyloliquefaciens Thiamine-phosphate synthase (thiE)

Ask
View Details
Recombinant Bacillus amyloliquefaciens Thiamine-phosphate synthase (thiE)
MBS1097345-02 0.1 mg (E-Coli)

Recombinant Bacillus amyloliquefaciens Thiamine-phosphate synthase (thiE)

Ask
View Details
Recombinant Bacillus amyloliquefaciens Thiamine-phosphate synthase (thiE)
MBS1097345-03 0.02 mg (Yeast)

Recombinant Bacillus amyloliquefaciens Thiamine-phosphate synthase (thiE)

Ask
View Details