Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORT1 Rabbit pAb (APR27822N)

Product Specifications

Background

This gene encodes a member of the VPS10-related sortilin family of proteins. The encoded preproprotein is proteolytically processed by furin to generate the mature receptor. This receptor plays a role in the trafficking of different proteins to either the cell surface, or subcellular compartments such as lysosomes and endosomes. Expression levels of this gene may influence the risk of myocardial infarction in human patients. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SORT1 Rabbit pAb (APR27822N) .

Synonyms

SORT1; Gp95; LDLCQ6; NT3; NTR3; sortilin

Gene ID

6272

UniProt

Q99523

Cellular Locus

Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Extracellular side, Golgi apparatus, Golgi stack membrane, Lysosome membrane, Membrane, Nucleus membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa/92kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6272

Uniprot URL

https://www.uniprot.org/uniprot/Q99523

AA Sequence

EGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPII

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (FITC)
MBS6124057-01 0.1 mL

Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (FITC)

Ask
View Details
Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (FITC)
MBS6124057-02 5x 0.1 mL

Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (FITC)

Ask
View Details
PFKM (6-phosphofructokinase, Muscle Type, Phosphofructokinase 1, Phosphohexokinase, Phosphofructo-1-kinase Isozyme A, PFK-A, Phosphofructokinase-M, PFKX, MGC8699) (PE)
131190-PE 100 µL

PFKM (6-phosphofructokinase, Muscle Type, Phosphofructokinase 1, Phosphohexokinase, Phosphofructo-1-kinase Isozyme A, PFK-A, Phosphofructokinase-M, PFKX, MGC8699) (PE)

Ask
View Details
Monoclonal Fc gamma RIIB/CD32b Antibody Pair [HRP]
NBP2-79669-15Plates 15 Plates

Monoclonal Fc gamma RIIB/CD32b Antibody Pair [HRP]

Ask
View Details
CCT020312 100mg
A19137-100 100 mg

CCT020312 100mg

Ask
View Details
BTD Rabbit pAb (APR20517N)
APR20517N-01 50 µL

BTD Rabbit pAb (APR20517N)

Ask
View Details