Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLOD1 Rabbit pAb (APR27815N)

Product Specifications

Background

Lysyl hydroxylase is a membrane-bound homodimeric protein localized to the cisternae of the endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VI have deficiencies in lysyl hydroxylase activity. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PLOD1 Rabbit pAb (APR27815N) .

Synonyms

PLOD1; EDS6; LH; LH1; LLH; PLOD

Gene ID

5351

UniProt

Q02809

Cellular Locus

Lumenal side, Peripheral membrane protein, Rough endoplasmic reticulum membrane

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 83kDa/88kDa Observed MW: 84KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5351

Uniprot URL

https://www.uniprot.org/uniprot/Q02809

AA Sequence

RQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPTIDIHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLMPHHDASTFTINIALNRVGVDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTRGTRYIAVSFVDP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVL-292 5mg
A13202-5 5 mg

AVL-292 5mg

Sign In for Pricing
View Details
TRAF3 Rabbit Polyclonal Antibody
TA306249 100 µg

TRAF3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR44 (PTGDR2) Human Gene Knockout Kit (CRISPR)
KN423378 1 Kit

GPR44 (PTGDR2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LILRB1, ID (LILRB1, ILT2, LIR1, MIR7, Leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, CD85j) (MaxLight 650)
MBS6316083-01 0.1 mL

LILRB1, ID (LILRB1, ILT2, LIR1, MIR7, Leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, CD85j) (MaxLight 650)

Sign In for Pricing
View Details
LILRB1, ID (LILRB1, ILT2, LIR1, MIR7, Leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, CD85j) (MaxLight 650)
MBS6316083-02 5x 0.1 mL

LILRB1, ID (LILRB1, ILT2, LIR1, MIR7, Leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, CD85j) (MaxLight 650)

Sign In for Pricing
View Details
SLC29A3 ORF Vector (Human) (pORF)
44086011 1.0 µg DNA

SLC29A3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details