Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE6A Rabbit pAb (APR27813N)

Product Specifications

Background

This gene encodes the cyclic-GMP (cGMP) -specific phosphodiesterase 6A alpha subunit, expressed in cells of the retinal rod outer segment. The phosphodiesterase 6 holoenzyme is a heterotrimer composed of an alpha, beta, and two gamma subunits. cGMP is an important regulator of rod cell membrane current, and its dynamic concentration is established by phosphodiesterase 6A cGMP hydrolysis and guanylate cyclase cGMP synthesis. The protein is a subunit of a key phototransduction enzyme and participates in processes of transmission and amplification of the visual signal. Mutations in this gene have been identified as one cause of autosomal recessive retinitis pigmentosa.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PDE6A Rabbit pAb (APR27813N) .

Synonyms

PDE6A; CGPR-A; PDEA; RP43

Gene ID

5145

UniProt

P16499

Cellular Locus

Cell membrane, Cytoplasmic side, Lipid-anchor

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 99kDa Observed MW: 120kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5145

Uniprot URL

https://www.uniprot.org/uniprot/P16499

AA Sequence

EHAIHMMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACDLSAITKPWEVQSQVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFVCTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYDAKMKVQEEKKQKQQSAKSAAAGNQPGGNPSPGGATTSKSCCIQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NEFL Matched Antibody Pair Set [ABP-S-051103]
ABP-S-051103 5 Plates

Human NEFL Matched Antibody Pair Set [ABP-S-051103]

Sign In for Pricing
View Details
Canine Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit
MBS9346985-01 48 Well

Canine Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit

Sign In for Pricing
View Details
Canine Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit
MBS9346985-02 96 Well

Canine Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit

Sign In for Pricing
View Details
Canine Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit
MBS9346985-03 5x 96 Well

Canine Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit

Sign In for Pricing
View Details
Canine Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit
MBS9346985-04 10x 96 Well

Canine Serine Protease Inhibitor Kazal Type 2 (SPINK2) ELISA Kit

Sign In for Pricing
View Details
Tas2r129 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV698989 1.0 µg DNA

Tas2r129 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details