Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA6 Rabbit pAb (APR27801N)

Product Specifications

Background

Interferon α-6 (IFN-α6) is a secreted protein which belongs to the α/β interferon family. IFN-α6 is produced bymacrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-α6 contains interferonalpha, beta and delta domain. IFN- α has antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IFNA6 Rabbit pAb (APR27801N) .

Synonyms

IFNA6; IFN-alphaK

Gene ID

3443

UniProt

P05013

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3443

Uniprot URL

https://www.uniprot.org/uniprot/P05013

AA Sequence

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK16 Protein Lysate (Mouse) with C-HA Tag
45730034 100 µg

STK16 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human Monoclonal CD200R1 Antibody (Janssen patent anti-CD200R1) [Janelia Fluor 635]
NBP3-28600JF635 0.1 mL

Human Monoclonal CD200R1 Antibody (Janssen patent anti-CD200R1) [Janelia Fluor 635]

Sign In for Pricing
View Details
ABLM1 Polyclonal Antibody
JOT-AP14058-01 50ul

ABLM1 Polyclonal Antibody

Sign In for Pricing
View Details
ABLM1 Polyclonal Antibody
JOT-AP14058-02 100ul

ABLM1 Polyclonal Antibody

Sign In for Pricing
View Details
Cotl1 3'UTR GFP Stable Cell Line
TU154253 1.0 mL

Cotl1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human DEP Domain Containing 6 (DEPDC6) ELISA Kit
MBS109652-01 48 Well

Human DEP Domain Containing 6 (DEPDC6) ELISA Kit

Sign In for Pricing
View Details