Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA6 Rabbit pAb (APR27801N)

Product Specifications

Background

Interferon α-6 (IFN-α6) is a secreted protein which belongs to the α/β interferon family. IFN-α6 is produced bymacrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-α6 contains interferonalpha, beta and delta domain. IFN- α has antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IFNA6 Rabbit pAb (APR27801N) .

Synonyms

IFNA6; IFN-alphaK

Gene ID

3443

UniProt

P05013

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3443

Uniprot URL

https://www.uniprot.org/uniprot/P05013

AA Sequence

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERI1, NT (ERI1, 3'EXO, THEX1, 3'-5' exoribonuclease 1, 3'-5' exonuclease ERI1, Eri-1 homolog, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, Protein 3'hExo) (Azide free) (HRP)
MBS6296518-01 0.2 mL

ERI1, NT (ERI1, 3'EXO, THEX1, 3'-5' exoribonuclease 1, 3'-5' exonuclease ERI1, Eri-1 homolog, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, Protein 3'hExo) (Azide free) (HRP)

Sign In for Pricing
View Details
ERI1, NT (ERI1, 3'EXO, THEX1, 3'-5' exoribonuclease 1, 3'-5' exonuclease ERI1, Eri-1 homolog, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, Protein 3'hExo) (Azide free) (HRP)
MBS6296518-02 5x 0.2 mL

ERI1, NT (ERI1, 3'EXO, THEX1, 3'-5' exoribonuclease 1, 3'-5' exonuclease ERI1, Eri-1 homolog, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, Protein 3'hExo) (Azide free) (HRP)

Sign In for Pricing
View Details
DNA polymerase delta subunit 2 (POLD2) Bovine ELISA Kit
C9367 96 Tests

DNA polymerase delta subunit 2 (POLD2) Bovine ELISA Kit

Sign In for Pricing
View Details
ZDHHC22 3'UTR Luciferase Stable Cell Line
TU028815 1.0 mL

ZDHHC22 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TTI1 CRISPRa sgRNA lentivector (set of three targets)(Human)
48715121 3x 1.0µg DNA

TTI1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PIK1 Polyclonal Antibody
MBS7154456 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PIK1 Polyclonal Antibody

Sign In for Pricing
View Details