Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA6 Rabbit pAb (APR27801N)

Product Specifications

Background

Interferon α-6 (IFN-α6) is a secreted protein which belongs to the α/β interferon family. IFN-α6 is produced bymacrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-α6 contains interferonalpha, beta and delta domain. IFN- α has antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IFNA6 Rabbit pAb (APR27801N) .

Synonyms

IFNA6; IFN-alphaK

Gene ID

3443

UniProt

P05013

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3443

Uniprot URL

https://www.uniprot.org/uniprot/P05013

AA Sequence

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7AP32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1884508 1.0 µg DNA

RPL7AP32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rat Thbs4 Pre-designed siRNA Set A
SI214491A 1 Each

Rat Thbs4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PADI6 (NM_207421) Human Tagged ORF Clone
RC218705 10 µg

PADI6 (NM_207421) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human EphA2 ELISA Kit (Colorimetric)
NBP3-18025 1 Kit

Human EphA2 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
UBAP2 (NM_018449) Human Over-expression Lysate
LS055833-100ug 100 µg

UBAP2 (NM_018449) Human Over-expression Lysate

Sign In for Pricing
View Details
BIN3 (bridging integrator 3, MGC14978) (FITC)
MBS6178126-01 0.1 mL

BIN3 (bridging integrator 3, MGC14978) (FITC)

Sign In for Pricing
View Details