Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA6 Rabbit pAb (APR27801N)

Product Specifications

Background

Interferon α-6 (IFN-α6) is a secreted protein which belongs to the α/β interferon family. IFN-α6 is produced bymacrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-α6 contains interferonalpha, beta and delta domain. IFN- α has antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IFNA6 Rabbit pAb (APR27801N) .

Synonyms

IFNA6; IFN-alphaK

Gene ID

3443

UniProt

P05013

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3443

Uniprot URL

https://www.uniprot.org/uniprot/P05013

AA Sequence

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vascular Endothelial Growth Factor Receptor 3 (VEGFR3) ELISA Kit
RD-VEGFR3-Ra-48Tests 48 Tests

Rat Vascular Endothelial Growth Factor Receptor 3 (VEGFR3) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-TAU (pS673) Antibody
YLD7595-01 50 µL

Rabbit anti-TAU (pS673) Antibody

Sign In for Pricing
View Details
Rabbit anti-TAU (pS673) Antibody
YLD7595-02 100 µL

Rabbit anti-TAU (pS673) Antibody

Sign In for Pricing
View Details
Caprisil C18-LC HPLC Column, 3 µm, 100 Å, CB535-C18-LC x 100 mm
CB335-C18-LC 3 µm

Caprisil C18-LC HPLC Column, 3 µm, 100 Å, CB535-C18-LC x 100 mm

Sign In for Pricing
View Details
Dhps (BC039963) Mouse Recombinant Protein
PM48499M5 20 µg

Dhps (BC039963) Mouse Recombinant Protein

Sign In for Pricing
View Details
L-Tetraguluronic acid
MF-0098092 1 mg

L-Tetraguluronic acid

Sign In for Pricing
View Details