Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cadherin 16 Rabbit pAb (APR27781N)

Product Specifications

Background

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. Mapped to a previously identified cluster of cadherin genes on chromosome 16q22.1, the gene localizes with superfamily members CDH1, CDH3, CDH5, CDH8 and CDH11. The protein consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development. Alternatively spliced transcript variants encoding distinct isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cadherin 16 Rabbit pAb (APR27781N) .

Synonyms

CDH16

Gene ID

1014

UniProt

O75309

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 79kDa/85kDa/87kDa/89kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1014

Uniprot URL

https://www.uniprot.org/uniprot/O75309

AA Sequence

KAQPAELSVEVPENYGGNFPLYLTKLPLPREGAEGQIVLSGDSGKATEGPFAMDPDSGFLLVTRALDREEQAEYQLQVTLEMQDGHVLWGPQPVLVHVKDENDQVPHFSQAIYRARLSRGTRPGIPFLFLEASDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLDHALERTYQLLVQVKDMGDQASGHQATATVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S497 Protein Vector (Human) (pPM-C-HA)
PV117688 500 ng

RN5S497 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)
MBS1248667-01 0.02 mg (E-Coli)

Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)
MBS1248667-02 0.1 mg (E-Coli)

Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)
MBS1248667-03 0.02 mg (Yeast)

Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)
MBS1248667-04 0.1 mg (Yeast)

Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)
MBS1248667-05 0.02 mg (Baculovirus)

Recombinant Lysinibacillus sphaericus Protein sprT-like (Bsph_4293)

Sign In for Pricing
View Details