Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Na+/K+-ATPase Rabbit pAb (APR27778N)

Product Specifications

Background

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta) . The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 1 subunit. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Na+/K+-ATPase Rabbit pAb (APR27778N) .

Synonyms

ATP1A1; ATPase Na+/K+ transporting subunit alpha 1; ATP1A; CMT2DD; HOMGSMR2

Gene ID

476

UniProt

P05023

Cellular Locus

Cell membrane, Melanosome, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 74kDa/109kDa/112kDa/113kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=476

Uniprot URL

https://www.uniprot.org/uniprot/P05023

AA Sequence

MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flotillin 1 Rabbit Monoclonal Antibody
AMRe03002-01 1 Each

Flotillin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Flotillin 1 Rabbit Monoclonal Antibody
AMRe03002-02 50 µL

Flotillin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Flotillin 1 Rabbit Monoclonal Antibody
AMRe03002-03 100 µL

Flotillin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Boc-S-acetamidomethyl-L-cysteine 4-oxymethylphenylacetamidomethyl resin
236685-01 1 g

Boc-S-acetamidomethyl-L-cysteine 4-oxymethylphenylacetamidomethyl resin

Sign In for Pricing
View Details
Boc-S-acetamidomethyl-L-cysteine 4-oxymethylphenylacetamidomethyl resin
236685-02 5 g

Boc-S-acetamidomethyl-L-cysteine 4-oxymethylphenylacetamidomethyl resin

Sign In for Pricing
View Details
Boc-S-acetamidomethyl-L-cysteine 4-oxymethylphenylacetamidomethyl resin
236685-03 25 g

Boc-S-acetamidomethyl-L-cysteine 4-oxymethylphenylacetamidomethyl resin

Sign In for Pricing
View Details