Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B Rabbit pAb (APR27770N)

Product Specifications

Background

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ACVR2B Rabbit pAb (APR27770N) .

Synonyms

ACVR2B; ACTRIIB; ActR-IIB; HTX4

Gene ID

93

UniProt

Q13705

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 58kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=93

Uniprot URL

https://www.uniprot.org/uniprot/Q13705

AA Sequence

EGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLTVLAYSLLPIGGLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-H-FABP Antibody
CQA1953-01 30 µL

Anti-H-FABP Antibody

Sign In for Pricing
View Details
Anti-H-FABP Antibody
CQA1953-02 50 μL

Anti-H-FABP Antibody

Sign In for Pricing
View Details
Anti-H-FABP Antibody
CQA1953-03 100 µL

Anti-H-FABP Antibody

Sign In for Pricing
View Details
Anti-H-FABP Antibody
CQA1953-04 200 µL

Anti-H-FABP Antibody

Sign In for Pricing
View Details
Gabapentin-d4 Hydrochloride Monohydrate
CS-O-06640 1 Each

Gabapentin-d4 Hydrochloride Monohydrate

Sign In for Pricing
View Details
MED12 Antibody, HRP conjugated
MBS7050973-01 0.05 mg

MED12 Antibody, HRP conjugated

Sign In for Pricing
View Details