Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCEAL8 Rabbit pAb (APR27750N)

Product Specifications

Background

This gene encodes a member of the transcription elongation factor A (SII) -like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCEAL8 Rabbit pAb (APR27750N) .

Synonyms

TCEAL8; WEX3

Gene ID

90843

UniProt

Q8IYN2

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=90843

Uniprot URL

https://www.uniprot.org/uniprot/Q8IYN2

AA Sequence

MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse basic fibroblast growth factor, bFGF ELISA Kit
MBS161967-01 48 Well

Mouse basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details
Mouse basic fibroblast growth factor, bFGF ELISA Kit
MBS161967-02 96 Well

Mouse basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details
Mouse basic fibroblast growth factor, bFGF ELISA Kit
MBS161967-03 5x 96 Well

Mouse basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details
Mouse basic fibroblast growth factor, bFGF ELISA Kit
MBS161967-04 10x 96 Well

Mouse basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details
Rat Potassium Two Pore Domain Channel Subfamily K Member 12 (KCNK12) ELISA Kit
abx529695 96 Tests

Rat Potassium Two Pore Domain Channel Subfamily K Member 12 (KCNK12) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CEACAM3/CD66d (C-6His)
32-7403-10 10 µg

Recombinant Human CEACAM3/CD66d (C-6His)

Sign In for Pricing
View Details