Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX22 Rabbit pAb (APR27711N)

Product Specifications

Background

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene have been associated with the inherited X-linked disorder, Cleft palate with ankyloglossia, and it is believed to play a major role in human palatogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TBX22 Rabbit pAb (APR27711N) .

Synonyms

TBX22; ABERS; CLPA; CPX; TBXX; dJ795G23.1; T-box 22

Gene ID

50945

UniProt

Q9Y458

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa/57kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=50945

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y458

AA Sequence

LDGLLETYPWRPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHLPTSSLGMPCPEAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHYL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ENPP-5 Antibody [CoraFluor 1]
NBP2-99809CL1 0.1 mL

Rabbit Polyclonal ENPP-5 Antibody [CoraFluor 1]

Ask
View Details
Stk24, ID (Stk24, Mst3, Stk3, Serine/threonine-protein kinase 24, Mammalian STE20-like protein kinase 3, STE20-like kinase MST3, Serine/threonine-protein kinase 24 35kD subunit, Mammalian STE20-like protein kinase 3 N-terminal, Serine/threonine-protein kinase 24 12kD subunit, Mammalian STE20-like protein kinase 3 C-terminal) (PE) discontinued
042400-PE 200 µL

Stk24, ID (Stk24, Mst3, Stk3, Serine/threonine-protein kinase 24, Mammalian STE20-like protein kinase 3, STE20-like kinase MST3, Serine/threonine-protein kinase 24 35kD subunit, Mammalian STE20-like protein kinase 3 N-terminal, Serine/threonine-protein kinase 24 12kD subunit, Mammalian STE20-like protein kinase 3 C-terminal) (PE) discontinued

Ask
View Details
IFT74 Antibody, Biotin conjugated
A64371-100UL 100 µL

IFT74 Antibody, Biotin conjugated

Ask
View Details
P53 (Tumor Suppressor Protein, Oncogene Protein) (BSA & Azide Free) (AP) discontinued
P1001-26CX-AP 100 µL

P53 (Tumor Suppressor Protein, Oncogene Protein) (BSA & Azide Free) (AP) discontinued

Ask
View Details
Icam1 (NM_010493) Mouse Tagged ORF Clone Lentiviral Particle
MR227081L3V 200 µL

Icam1 (NM_010493) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (MaxLight 490)
MBS6203612-01 0.1 mL

SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (MaxLight 490)

Ask
View Details