Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSND Rabbit pAb (APR27662N)

Product Specifications

Background

This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BSND Rabbit pAb (APR27662N) .

Synonyms

BSND; BART; DFNB73; barttin

Gene ID

7809

UniProt

Q8WZ55

Cellular Locus

Cell membrane, Cytoplasm, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7809

Uniprot URL

https://www.uniprot.org/uniprot/Q8WZ55

AA Sequence

CQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMCO1 (NM_019026) Human Over-expression Lysate
LC402729 20 µg

TMCO1 (NM_019026) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccdc117 Mouse Gene Knockout Kit (CRISPR)
KN502642 1 Kit

Ccdc117 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OptiWell™ DeepWell Plates
D3384-03S 50 Units/Case

OptiWell™ DeepWell Plates

Sign In for Pricing
View Details
Mouse Pcdha5 activation kit by CRISPRa
GA200885 1 Kit

Mouse Pcdha5 activation kit by CRISPRa

Sign In for Pricing
View Details
(E)-3-(5-Nitrofuran-2-yl)acrylaldehyde
TRC-N495950-50MG 50 mg

(E)-3-(5-Nitrofuran-2-yl)acrylaldehyde

Sign In for Pricing
View Details
Tsx Mouse Gene Knockout Kit (CRISPR)
KN518389 1 Kit

Tsx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details