Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSND Rabbit pAb (APR27662N)

Product Specifications

Background

This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BSND Rabbit pAb (APR27662N) .

Synonyms

BSND; BART; DFNB73; barttin

Gene ID

7809

UniProt

Q8WZ55

Cellular Locus

Cell membrane, Cytoplasm, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7809

Uniprot URL

https://www.uniprot.org/uniprot/Q8WZ55

AA Sequence

CQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFAP2B Polyclonal Antibody
E-AB-66159-01 60 µL

TFAP2B Polyclonal Antibody

Sign In for Pricing
View Details
TFAP2B Polyclonal Antibody
E-AB-66159-02 120 µL

TFAP2B Polyclonal Antibody

Sign In for Pricing
View Details
TFAP2B Polyclonal Antibody
E-AB-66159-03 200 µL

TFAP2B Polyclonal Antibody

Sign In for Pricing
View Details
Semaphorin 3B (SEMA3B) (NM_001290060) Human Tagged ORF Clone
RG239473 10 µg

Semaphorin 3B (SEMA3B) (NM_001290060) Human Tagged ORF Clone

Sign In for Pricing
View Details
ACK1 (TNK2) (Center) Rabbit Polyclonal Antibody
AP17079PU-N 400 µL

ACK1 (TNK2) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Trem2 Recombinant Rabbit Monoclonal Antibody [PSH02-03] - BSA and Azide free (Detector)
HA721761 100 µL

Mouse Trem2 Recombinant Rabbit Monoclonal Antibody [PSH02-03] - BSA and Azide free (Detector)

Sign In for Pricing
View Details