Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VRK1 Rabbit pAb (APR27660N)

Product Specifications

Background

This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VRK1 Rabbit pAb (APR27660N) .

Synonyms

VRK1; PCH1; PCH1A

Gene ID

7443

UniProt

Q99986

Cellular Locus

Cytoplasm, Nucleus, cytoskeleton, spindle

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7443

Uniprot URL

https://www.uniprot.org/uniprot/Q99986

AA Sequence

GHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Chitinase-3-like Protein 1 (YKL-40/CHI3L1) ELISA Kit
MBS164686-01 48 Well

Human Chitinase-3-like Protein 1 (YKL-40/CHI3L1) ELISA Kit

Sign In for Pricing
View Details
Human Chitinase-3-like Protein 1 (YKL-40/CHI3L1) ELISA Kit
MBS164686-02 96 Well

Human Chitinase-3-like Protein 1 (YKL-40/CHI3L1) ELISA Kit

Sign In for Pricing
View Details
Human Chitinase-3-like Protein 1 (YKL-40/CHI3L1) ELISA Kit
MBS164686-03 5x 96 Well

Human Chitinase-3-like Protein 1 (YKL-40/CHI3L1) ELISA Kit

Sign In for Pricing
View Details
Human Chitinase-3-like Protein 1 (YKL-40/CHI3L1) ELISA Kit
MBS164686-04 10x 96 Well

Human Chitinase-3-like Protein 1 (YKL-40/CHI3L1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human HEXIM1 Protein, N-GST & C-His
orb3154215-01 50 µg

Recombinant Human HEXIM1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human HEXIM1 Protein, N-GST & C-His
orb3154215-02 100 µg

Recombinant Human HEXIM1 Protein, N-GST & C-His

Sign In for Pricing
View Details