Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNC2 Rabbit pAb (APR27655N)

Product Specifications

Background

Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TNNC2 Rabbit pAb (APR27655N) .

Synonyms

TNNC2; troponin C

Gene ID

7125

UniProt

P02585

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7125

Uniprot URL

https://www.uniprot.org/uniprot/P02585

AA Sequence

MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC3 (NM_014408) Human Tagged ORF Clone
RG200602 10 µg

TRAPPC3 (NM_014408) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-KDEL Receptor 2/KDELR2 Polyclonal Antibody
PAV8432 100 μL

Rabbit Anti-KDEL Receptor 2/KDELR2 Polyclonal Antibody

Sign In for Pricing
View Details
Cholera toxin Matched Antibody Pair Set [ABP-S-07474]
ABP-S-07474 5 Plates

Cholera toxin Matched Antibody Pair Set [ABP-S-07474]

Sign In for Pricing
View Details
Catenin, beta, aa27-37 discontinued
C2069-48B 100 µg

Catenin, beta, aa27-37 discontinued

Sign In for Pricing
View Details
TMEM35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2388806 1.0 µg DNA

TMEM35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
(R)-1-Aminoindane Hydrochloride
TRC-A611713-1G 1 g

(R)-1-Aminoindane Hydrochloride

Sign In for Pricing
View Details