Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNC2 Rabbit pAb (APR27655N)

Product Specifications

Background

Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TNNC2 Rabbit pAb (APR27655N) .

Synonyms

TNNC2; troponin C

Gene ID

7125

UniProt

P02585

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7125

Uniprot URL

https://www.uniprot.org/uniprot/P02585

AA Sequence

MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyb561d1 (NM_001277236) Rat Untagged Clone
RN216097 10 µg

Cyb561d1 (NM_001277236) Rat Untagged Clone

Sign In for Pricing
View Details
RPL31P48 sgRNA CRISPR Lentivector (Human) (Target 3)
K1964904 1.0 µg DNA

RPL31P48 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PTHB1, CT (BBS9, PTHB1, Protein PTHB1, Bardet-Biedl syndrome 9 protein, Parathyroid hormone-responsive B1 gene protein) (Azide free) (HRP) discontinued
040634-HRP 200 µL

PTHB1, CT (BBS9, PTHB1, Protein PTHB1, Bardet-Biedl syndrome 9 protein, Parathyroid hormone-responsive B1 gene protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1)
127673 100 µg

GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1)

Sign In for Pricing
View Details
PIRES2-EGFP-NUMB
PPL00760-2a 1 Each

PIRES2-EGFP-NUMB

Sign In for Pricing
View Details
Anti-TTX Antibody (8Y943)
MF-0091149-01 50 µL

Anti-TTX Antibody (8Y943)

Sign In for Pricing
View Details