Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT4 Rabbit pAb (APR27652N)

Product Specifications

Background

Synaptotagmin family member which does not bind Ca (2+ (By similarity. Involved in neuronal dense core vesicles (DCVs mobility through its interaction with KIF1A. Upon increased neuronal activity, phosphorylation by MAPK8/JNK1 destabilizes the interaction with KIF1A and captures DCVs to synapses (By similarity. Plays a role in dendrite formation by melanocytes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYT4 Rabbit pAb (APR27652N) .

Synonyms

SYT4; HsT1192

Gene ID

6860

UniProt

Q9H2B2

Cellular Locus

Cytoplasmic vesicle, Single-pass membrane protein, secretory vesicle, synaptic vesicle membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa/47kDa Observed MW: 48kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6860

Uniprot URL

https://www.uniprot.org/uniprot/Q9H2B2

AA Sequence

CQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cav1.3 Antibody (PerCP)
abx444037 100 µg

Cav1.3 Antibody (PerCP)

Sign In for Pricing
View Details
STAG2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2298204 1.0 µg DNA

STAG2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Atp6v1h shRNA (UAS) - Lentiviral mouse Atp6v1h shRNA (UAS, RFP) (25)
GTR15204059 1 Vial

Lentiviral mouse Atp6v1h shRNA (UAS) - Lentiviral mouse Atp6v1h shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rat Clgn Pre-designed siRNA Set A
SI202883A 1 Each

Rat Clgn Pre-designed siRNA Set A

Sign In for Pricing
View Details
Reagecon Calibration and Vertification Kit for Total Organic/Inorganic Carbon (TOC/TIC) suitable for use with Sievers 900/M9 Analysers
RC120021 8x40ml

Reagecon Calibration and Vertification Kit for Total Organic/Inorganic Carbon (TOC/TIC) suitable for use with Sievers 900/M9 Analysers

Sign In for Pricing
View Details
ADRA1C Antibody
MBS9409521-01 0.1 mL

ADRA1C Antibody

Sign In for Pricing
View Details