Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT4 Rabbit pAb (APR27652N)

Product Specifications

Background

Synaptotagmin family member which does not bind Ca (2+ (By similarity. Involved in neuronal dense core vesicles (DCVs mobility through its interaction with KIF1A. Upon increased neuronal activity, phosphorylation by MAPK8/JNK1 destabilizes the interaction with KIF1A and captures DCVs to synapses (By similarity. Plays a role in dendrite formation by melanocytes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SYT4 Rabbit pAb (APR27652N) .

Synonyms

SYT4; HsT1192

Gene ID

6860

UniProt

Q9H2B2

Cellular Locus

Cytoplasmic vesicle, Single-pass membrane protein, secretory vesicle, synaptic vesicle membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa/47kDa Observed MW: 48kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6860

Uniprot URL

https://www.uniprot.org/uniprot/Q9H2B2

AA Sequence

CQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAP3 Rabbit Polyclonal Antibody (Fluoro550)
orb3112231 100 µg

LAP3 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Lentiviral human ITPRID2 shRNA (UAS) - Lentiviral human ITPRID2 shRNA (UAS, iRFP) (25)
GTR15150854 1 Vial

Lentiviral human ITPRID2 shRNA (UAS) - Lentiviral human ITPRID2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ADH4 (F-6)
sc-515217 200 µg/mL

ADH4 (F-6)

Sign In for Pricing
View Details
Glycam1-set siRNA/shRNA/RNAi Lentivector (Rat)
21670096 4x 500 ng

Glycam1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Canine Hepatocyte Growth Factor (HGF) ELISA Kit
MBS453974-01 48 Tests

Canine Hepatocyte Growth Factor (HGF) ELISA Kit

Sign In for Pricing
View Details
Canine Hepatocyte Growth Factor (HGF) ELISA Kit
MBS453974-02 96 Tests

Canine Hepatocyte Growth Factor (HGF) ELISA Kit

Sign In for Pricing
View Details