Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rac1/2/3 Rabbit pAb (APR27636N)

Product Specifications

Background

The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Rac1/2/3 Rabbit pAb (APR27636N) .

Synonyms

RAC1; MIG5; Rac-1; TC-25; p21-Rac1

Gene ID

5879

UniProt

P63000

Cellular Locus

Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Melanosome

Applications

WB (Human lung cancer cell, Rattus norvegicus, Capra hircus, Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/23kDa Observed MW: 21KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5879

Uniprot URL

https://www.uniprot.org/uniprot/P63000

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jag1 3'UTR GFP Stable Cell Line
TU256464 1.0 mL

Jag1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RBPMS Rabbit Polyclonal Antibody (BF647)
orb2465689 100 µL

RBPMS Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Recombinant Human MAP1B Protein
E30P4874 20 µg

Recombinant Human MAP1B Protein

Sign In for Pricing
View Details
Human KCTD20 knockout cell line
ABC-KH7757 1 Vial

Human KCTD20 knockout cell line

Sign In for Pricing
View Details
EDG1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-7112R-BF555-TR 20 µL

EDG1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Mpdu1 (NM_011900) Mouse Tagged ORF Clone
MG219849 10 µg

Mpdu1 (NM_011900) Mouse Tagged ORF Clone

Sign In for Pricing
View Details