Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY1 Rabbit pAb (APR27624N)

Product Specifications

Background

The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality P2RY1 Rabbit pAb (APR27624N) .

Synonyms

P2RY1; P2Y1

Gene ID

5028

UniProt

P47900

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5028

Uniprot URL

https://www.uniprot.org/uniprot/P47900

AA Sequence

IPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calsenilin-Like Protein (KCNIP4) Antibody
abx302003-01 20 µg

Calsenilin-Like Protein (KCNIP4) Antibody

Sign In for Pricing
View Details
Calsenilin-Like Protein (KCNIP4) Antibody
abx302003-02 50 µg

Calsenilin-Like Protein (KCNIP4) Antibody

Sign In for Pricing
View Details
Calsenilin-Like Protein (KCNIP4) Antibody
abx302003-03 100 µg

Calsenilin-Like Protein (KCNIP4) Antibody

Sign In for Pricing
View Details
Calsenilin-Like Protein (KCNIP4) Antibody
abx302003-04 200 µg

Calsenilin-Like Protein (KCNIP4) Antibody

Sign In for Pricing
View Details
Calsenilin-Like Protein (KCNIP4) Antibody
abx302003-05 1 mg

Calsenilin-Like Protein (KCNIP4) Antibody

Sign In for Pricing
View Details
Mouse Son of sevenless homolog 1, SOS1 ELISA Kit
MBS9318489-01 48 Well

Mouse Son of sevenless homolog 1, SOS1 ELISA Kit

Sign In for Pricing
View Details