Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA6 Rabbit pAb (APR27609N)

Product Specifications

Background

Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HSPA6 Rabbit pAb (APR27609N) .

Synonyms

HSPA6; HSP70B

Gene ID

3310

UniProt

P17066

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 71kDa Observed MW: 71kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3310

Uniprot URL

https://www.uniprot.org/uniprot/P17066

AA Sequence

PQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CD19 (Tyr531) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3065R-BF680 100 µL

Phospho-CD19 (Tyr531) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
CCNG1, 1-295aa, Human, His tag, E Coli
MBS204588-01 0.01 mg

CCNG1, 1-295aa, Human, His tag, E Coli

Sign In for Pricing
View Details
CCNG1, 1-295aa, Human, His tag, E Coli
MBS204588-02 0.05 mg

CCNG1, 1-295aa, Human, His tag, E Coli

Sign In for Pricing
View Details
CCNG1, 1-295aa, Human, His tag, E Coli
MBS204588-03 5x 0.01 mg

CCNG1, 1-295aa, Human, His tag, E Coli

Sign In for Pricing
View Details
CCNG1, 1-295aa, Human, His tag, E Coli
MBS204588-04 0.25 mg

CCNG1, 1-295aa, Human, His tag, E Coli

Sign In for Pricing
View Details
CCNG1, 1-295aa, Human, His tag, E Coli
MBS204588-05 5x 0.05 mg

CCNG1, 1-295aa, Human, His tag, E Coli

Sign In for Pricing
View Details