Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B3 Rabbit pAb (APR27608N)

Product Specifications

Background

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HSD17B3 Rabbit pAb (APR27608N) .

Synonyms

HSD17B3; EDH17B3; SDR12C2

Gene ID

3293

UniProt

P37058

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/34kDa Observed MW: 34kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3293

Uniprot URL

https://www.uniprot.org/uniprot/P37058

AA Sequence

MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Astrocyte Culture Medium
ARM1031 500 mL

Human Astrocyte Culture Medium

Sign In for Pricing
View Details
Lentiviral human TBC1D8 sgRNA gene knockout kit - Lentiviral human TBC1D8 sgRNA gene knockout kit (plasmid)
GTR15392525 1 Vial

Lentiviral human TBC1D8 sgRNA gene knockout kit - Lentiviral human TBC1D8 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PBK Rabbit Polyclonal Antibody
orb580542 100 µL

PBK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3632451O06RIK Adenovirus (Mouse)
10546054 1.0 mL

3632451O06RIK Adenovirus (Mouse)

Sign In for Pricing
View Details
DNA2 Antibody
orb1278100 100 µL

DNA2 Antibody

Sign In for Pricing
View Details
CXCR-3 shRNA Plasmid (m)
sc-39903-SH 20 µg

CXCR-3 shRNA Plasmid (m)

Sign In for Pricing
View Details