Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPB Rabbit pAb (APR27605N)

Product Specifications

Background

Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5' UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. Alternate splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GYPB Rabbit pAb (APR27605N) .

Synonyms

GYPB; CD235b; GPB; GYP; MNS; PAS-3; SS

Gene ID

2994

UniProt

P06028

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 6kDa/9kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2994

Uniprot URL

https://www.uniprot.org/uniprot/P06028

AA Sequence

MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MMP1 Protein, His, E.coli-50ug
QP8564-ec-50ug 50ug

Recombinant Human MMP1 Protein, His, E.coli-50ug

Sign In for Pricing
View Details
HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (MaxLight 650)
MBS6227964-01 0.1 mL

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (MaxLight 650)

Sign In for Pricing
View Details
HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (MaxLight 650)
MBS6227964-02 5x 0.1 mL

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae wecF Protein (aa 1-359)
VAng-Lsx07567-500gEcoli 500 µg (E. coli)

Recombinant Shigella Dysenteriae wecF Protein (aa 1-359)

Sign In for Pricing
View Details
RNASE3 Protein (C-His, Human)
P518049 100 µg

RNASE3 Protein (C-His, Human)

Sign In for Pricing
View Details
Rabbit Polyclonal AHNAK2 Antibody [Alexa Fluor 488]
NBP2-98657AF488 0.1 mL

Rabbit Polyclonal AHNAK2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details