Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A2 Rabbit pAb (APR27603N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GTF2A2 Rabbit pAb (APR27603N) .

Synonyms

GTF2A2; HsT18745; T18745; TF2A2; TFIIA; TFIIA-12; TFIIA-gamma; TFIIAS

Gene ID

2958

UniProt

P52657

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2958

Uniprot URL

https://www.uniprot.org/uniprot/P52657

AA Sequence

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCLN Antibody
8C17048-AAT 50 µg

NCLN Antibody

Sign In for Pricing
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (HRP)
MBS6180366-01 0.1 mL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (HRP)

Sign In for Pricing
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (HRP)
MBS6180366-02 5x 0.1 mL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (HRP)

Sign In for Pricing
View Details
ZAP70 (Zeta Chain Associated Protein Kinase 70kD, FLJ17670, FLJ17679, SRK, STD, TZK, ZAP-70) discontinued
214210-01 20 µL

ZAP70 (Zeta Chain Associated Protein Kinase 70kD, FLJ17670, FLJ17679, SRK, STD, TZK, ZAP-70) discontinued

Sign In for Pricing
View Details
ZAP70 (Zeta Chain Associated Protein Kinase 70kD, FLJ17670, FLJ17679, SRK, STD, TZK, ZAP-70) discontinued
214210-02 100 µL

ZAP70 (Zeta Chain Associated Protein Kinase 70kD, FLJ17670, FLJ17679, SRK, STD, TZK, ZAP-70) discontinued

Sign In for Pricing
View Details
C11orf63 ORF Vector (Human) (pORF)
13707011 1.0 µg DNA

C11orf63 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details