Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIDEA Rabbit pAb (APR27582N)

Product Specifications

Background

This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CIDEA Rabbit pAb (APR27582N) .

Synonyms

CIDEA; CIDE-A

Gene ID

1149

UniProt

O60543

Cellular Locus

Lipid droplet, Nucleus

Dilution

IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1149

Uniprot URL

https://www.uniprot.org/uniprot/O60543

AA Sequence

SQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLDA2, 1-152aa, Human, His tag, E Coli
MBS203744-01 0.01 mg

PHLDA2, 1-152aa, Human, His tag, E Coli

Sign In for Pricing
View Details
PHLDA2, 1-152aa, Human, His tag, E Coli
MBS203744-02 0.02 mg

PHLDA2, 1-152aa, Human, His tag, E Coli

Sign In for Pricing
View Details
PHLDA2, 1-152aa, Human, His tag, E Coli
MBS203744-03 0.05 mg

PHLDA2, 1-152aa, Human, His tag, E Coli

Sign In for Pricing
View Details
PHLDA2, 1-152aa, Human, His tag, E Coli
MBS203744-04 0.1 mg

PHLDA2, 1-152aa, Human, His tag, E Coli

Sign In for Pricing
View Details
PHLDA2, 1-152aa, Human, His tag, E Coli
MBS203744-05 0.25 mg

PHLDA2, 1-152aa, Human, His tag, E Coli

Sign In for Pricing
View Details
PHLDA2, 1-152aa, Human, His tag, E Coli
MBS203744-06 5x 0.01 mg

PHLDA2, 1-152aa, Human, His tag, E Coli

Sign In for Pricing
View Details