Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPOP Rabbit pAb (APR27552N)

Product Specifications

Background

This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPOP Rabbit pAb (APR27552N) .

Synonyms

SPOP; BTBD32; TEF2

Gene ID

20747

Cellular Locus

Nucleus, Nucleus speckle

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=20747

AA Sequence

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PRD Rabbit Monoclonal Antibody, Carrier-free
M03417-2-carrier-free 100 µL

Anti-PRD Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
LAMP1 (NM_005561) Human Untagged Clone
SC317667 10 µg

LAMP1 (NM_005561) Human Untagged Clone

Sign In for Pricing
View Details
CYP21A2 Protein Lysate (Human) with C-Ha Tag
17325031 100 µg

CYP21A2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Pou2f2 (NM_011138) Mouse Tagged ORF Clone
MG223353 10 µg

Pou2f2 (NM_011138) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RANBP1B Polyclonal Antibody
MBS9006178 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RANBP1B Polyclonal Antibody

Sign In for Pricing
View Details
Canine S100A11 ELISA Kit
ECS0027 96 Tests

Canine S100A11 ELISA Kit

Sign In for Pricing
View Details