Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPOP Rabbit pAb (APR27552N)

Product Specifications

Background

This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPOP Rabbit pAb (APR27552N) .

Synonyms

SPOP; BTBD32; TEF2

Gene ID

20747

Cellular Locus

Nucleus, Nucleus speckle

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=20747

AA Sequence

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51L3 antibody
70R-10335 100 µL

RAD51L3 antibody

Sign In for Pricing
View Details
vanin-1 HDR Plasmid (h2)
sc-406512-HDR-2 20 µg

vanin-1 HDR Plasmid (h2)

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Depression, Brain, Frontal Lobe (Paraffin) HisTekTM
T5595-5120A 5 Slides

Tissue, Section, Human Disease, Depression, Brain, Frontal Lobe (Paraffin) HisTekTM

Sign In for Pricing
View Details
Recombinant Mouse Inactive phospholipase D5 (Pld5), partial
MBS1346602-01 0.5 mg (E-Coli)

Recombinant Mouse Inactive phospholipase D5 (Pld5), partial

Sign In for Pricing
View Details
Recombinant Mouse Inactive phospholipase D5 (Pld5), partial
MBS1346602-02 0.05 mg (Baculovirus)

Recombinant Mouse Inactive phospholipase D5 (Pld5), partial

Sign In for Pricing
View Details
Recombinant Mouse Inactive phospholipase D5 (Pld5), partial
MBS1346602-03 0.5 mg (Yeast)

Recombinant Mouse Inactive phospholipase D5 (Pld5), partial

Sign In for Pricing
View Details