Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAF250 Rabbit pAb (APR27540N)

Product Specifications

Background

This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms

ARID1A; B120; BAF250; BAF250a; BM029; C1orf4; CSS2; ELD; MRD14; OSA1; P270; SMARCF1; hELD; hOSA1

Gene ID

93760

Cellular Locus

Nucleus

Dilution

IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 206kDa/218kDa/242kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BAF250 Rabbit pAb (APR27540N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=93760

AA Sequence

NMGTGAPQPNLMPSTPDSGMYSPSRYPPQQQQQQQQQHDSYGNQFSTQGTPSSSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSAGQGQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal COA6 Antibody [PerCP]
NBP3-06320PCP 0.1 mL

Rabbit Polyclonal COA6 Antibody [PerCP]

Ask
View Details
GALP Antibody: FITC (ARP63212_P050-FITC)
ARP63212_P050-FITC 100 µL

GALP Antibody: FITC (ARP63212_P050-FITC)

Ask
View Details
Atp2b3 Mouse Gene Knockout Kit (CRISPR)
KN501781 1 Kit

Atp2b3 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Nori® Porcine 2-Plex ELISA Kits-IL1A/TNFa
GR224051 96 Well

Nori® Porcine 2-Plex ELISA Kits-IL1A/TNFa

Ask
View Details
TC 21 CRISPR Activation Plasmid (m2)
sc-426269-ACT-2 20 µg

TC 21 CRISPR Activation Plasmid (m2)

Ask
View Details